Recombinant Human PDZ domain-containing protein 11 (PDZD11)

Product Description

Recombinant Human PDZ domain-containing protein 11 (PDZD11) is available at Gentaur for Next week Delivery.

Gene Name: PDZD11

Alternative Names : ATPase-interacting PDZ protein;Plasma membrane calcium ATPase-interacting single-PDZ protein;PMCA-interacting single-PDZ protein

Expression Region : 1-140aa

AA Sequence : MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 32.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 1: Cytoplasm

Protein Families :

Tissue Specificity : Widely expressed (at protein level).

Paythway :

Uniprot ID : Q5EBL8