Product Description
Recombinant Human PDZ domain-containing protein 11 (PDZD11) is available at Gentaur for Next week Delivery.
Gene Name: PDZD11
Alternative Names : ATPase-interacting PDZ protein;Plasma membrane calcium ATPase-interacting single-PDZ protein;PMCA-interacting single-PDZ protein
Expression Region : 1-140aa
AA Sequence : MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 32.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 1: Cytoplasm
Protein Families :
Tissue Specificity : Widely expressed (at protein level).
Paythway :
Uniprot ID : Q5EBL8
Euro
British Pound
US Dollar