Product Description
Recombinant Human Peptide YY protein (PYY), partial is available at Gentaur for Next week Delivery.
Gene Name: PYY
Alternative Names : PYY-I
Expression Region : 31-64aa
AA Sequence : IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 31.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Metabolism
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
Function : This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
Involvement in disease :
Subcellular location : Secreted
Protein Families : NPY family
Tissue Specificity :
Paythway :
Uniprot ID : P10082
Euro
British Pound
US Dollar