Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP14 (FKBP14)

Product Description

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP14 (FKBP14) is available at Gentaur for Next week Delivery.

Gene Name: FKBP14

Alternative Names : 22KDA FK506-binding protein;22KDA FKBP;FKBP-22FK506-binding protein 14;FKBP-14Rotamase

Expression Region : 20-211aa

AA Sequence : ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 38 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : PPIases accelerate the folding of proteins during protein synthesis.

Function : PPIases accelerate the folding of proteins during protein synthesis.

Involvement in disease : Ehlers-Danlos syndrome, with progressive kyphoscoliosis, myopathy, and hearing loss (EDSKMH)

Subcellular location : Endoplasmic reticulum lumen

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q9NWM8