Product Description
Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP1A (FKBP1A), partial is available at Gentaur for Next week Delivery.
Gene Name: FKBP1A
Alternative Names : 12KDA FK506-binding protein;12KDA FKBP;FKBP-12;Calstabin-1FK506-binding protein 1A;FKBP-1AImmunophilin FKBP12Rotamase
Expression Region : 2-103aa
AA Sequence : GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 38.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruites SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Function : Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Involvement in disease :
Subcellular location : Cytoplasm, cytosol, Sarcoplasmic reticulum membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families : FKBP-type PPIase family, FKBP1 subfamily
Tissue Specificity :
Paythway :
Uniprot ID : P62942
Euro
British Pound
US Dollar