Recombinant Human Phosphatidylserine synthase 1 (PTDSS1), partial

Product Description

Recombinant Human Phosphatidylserine synthase 1 (PTDSS1), partial is available at Gentaur for Next week Delivery.

Gene Name: PTDSS1

Alternative Names : Serine-exchange enzyme I

Expression Region : 1-35aa

AA Sequence : MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 31.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In mbranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.

Function : Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In membranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.

Involvement in disease : Lenz-Majewski hyperostotic dwarfism (LMHD)

Subcellular location : Endoplasmic reticulum membrane, Multi-pass membrane protein

Protein Families : Phosphatidyl serine synthase family

Tissue Specificity :

Paythway :

Uniprot ID : P48651