Recombinant Human Phosphoserine phosphatase (PSPH)

Product Description

Recombinant Human Phosphoserine phosphatase (PSPH) is available at Gentaur for Next week Delivery.

Gene Name: PSPH

Alternative Names : L-3-phosphoserine phosphatase O-phosphoserine phosphohydrolase

Expression Region : 1-225aa

AA Sequence : MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 52 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates

Function : Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates.

Involvement in disease : Phosphoserine phosphatase deficiency (PSPHD)

Subcellular location :

Protein Families : HAD-like hydrolase superfamily, SerB family

Tissue Specificity :

Paythway :

Uniprot ID : P78330