Recombinant Human Phytanoyl-CoA dioxygenase, peroxisomal (PHYH)

Product Description

Recombinant Human Phytanoyl-CoA dioxygenase, peroxisomal (PHYH) is available at Gentaur for Next week Delivery.

Gene Name: PHYH

Alternative Names : Phytanic acid oxidase Phytanoyl-CoA alpha-hydroxylase

Expression Region : 1-338aa

AA Sequence : SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 62.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.

Function : Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.

Involvement in disease : Refsum disease (RD)

Subcellular location : Peroxisome

Protein Families : PhyH family

Tissue Specificity : Expressed in liver, kidney, and T-cells, but not in spleen, brain, heart, lung and skeletal muscle.

Paythway :

Uniprot ID : O14832