Recombinant Human Platelet-derived growth factor subunit A (PDGFA) (Active)

Product Description

Recombinant Human Platelet-derived growth factor subunit A (PDGFA) (Active) is available at Gentaur for Next week Delivery.

Gene Name: PDGFA

Alternative Names : Platelet-derived growth factor subunit A;PDGF subunit A;PDGF-1;Platelet-derived growth factor A chain;Platelet-derived growth factor alpha polypeptide; PDGFA;PDGF1

Expression Region : 87-211aa

AA Sequence : SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 14.1 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 4 mM HCl

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 300 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Platelet-derived growth factor subunit A (PDGFA), belongs to the PDGF/VEGF growth factor family. PDGFA is a secreted protein, stored in platelet alpha-granules and released by platelets upon wounding. PDGFA is potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. It plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. PDGFA is required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis, normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. It plays an important role in wound healing; Signaling is modulated by the formation of heterodimers with PDGFB.

Function : Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis. Required for normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFB (By similarity).

Involvement in disease :

Subcellular location : Secreted

Protein Families : PDGF/VEGF growth factor family

Tissue Specificity :

Paythway : Jak-STATsignalingpathway

Uniprot ID : P04085