Recombinant Human Platelet-derived growth factor subunit B (PDGFB) (Active)

Product Description

Recombinant Human Platelet-derived growth factor subunit B (PDGFB) (Active) is available at Gentaur for Next week Delivery.

Gene Name: PDGFB

Alternative Names : Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS

Expression Region : 82-190aa

AA Sequence : SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 12.42 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 4 mM HCl

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 50 ng/mL.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Platelet-Derived Growth Factor Subunit B (PDGFB) belongs to the PDGF/VEGF growth factor family. Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma.Binding of PDGFB to its receptor elicits a variety of cellular responses. In addition, PDGFB is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound.

Function : Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin

Involvement in disease : Basal ganglia calcification, idiopathic, 5 (IBGC5)

Subcellular location : Secreted

Protein Families : PDGF/VEGF growth factor family

Tissue Specificity : Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung.

Paythway : Jak-STATsignalingpathway

Uniprot ID : P01127