Recombinant Human Pleckstrin homology domain-containing family B member 2 (PLEKHB2)

Product Description

Recombinant Human Pleckstrin homology domain-containing family B member 2 (PLEKHB2) is available at Gentaur for Next week Delivery.

Gene Name: PLEKHB2

Alternative Names : Evectin-2

Expression Region : 1-222aa

AA Sequence : MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 40.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in retrograde transport of recycling endosomes.

Function : Involved in retrograde transport of recycling endosomes.

Involvement in disease :

Subcellular location : Recycling endosome membrane, Peripheral membrane protein

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q96CS7