Product Description
Recombinant Human Pleckstrin homology-like domain family A member 2 (PHLDA2) is available at Gentaur for Next week Delivery.
Gene Name: PHLDA2
Alternative Names : Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein Imprinted in placenta and liver protein Tumor-suppressing STF cDNA 3 protein Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein p17-Beckwith-Wiedemann region 1 C
Expression Region : 1-152aa
AA Sequence : MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 44.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids
Function : Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).
Involvement in disease :
Subcellular location : Cytoplasm, Membrane, Peripheral membrane protein
Protein Families : PHLDA2 family
Tissue Specificity : Expressed in placenta and adult prostate gland. In placenta, it is present in all cells of the villous cytotrophoblast. The protein is absent in cells from hydatidiform moles. Hydatidiform mole is a gestation characterized by abnormal development of both fetus and trophoblast. The majority of hydatidiform moles are associated with an excess of paternal to maternal genomes and are likely to result from the abnormal expression of imprinted genes (at protein level). Expressed at low levels in adult liver and lung, and fetal liver. Expressed in adult brain and neuroblastoma, medullablastoma and glioblastoma cell lines.
Paythway :
Uniprot ID : Q53GA4
Euro
British Pound
US Dollar