Recombinant Human Potassium channel subfamily K member 2 (KCNK2), partial

Product Description

Recombinant Human Potassium channel subfamily K member 2 (KCNK2), partial is available at Gentaur for Next week Delivery.

Gene Name: KCNK2

Alternative Names : Outward rectifying potassium channel protein TREK-1 TREK-1 K(+) channel subunit Two pore domain potassium channel TREK-1 Two pore potassium channel TPKC1

Expression Region : 1-143aa

AA Sequence : MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWD

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 17.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ion channel that contributes to passive transmembrane potassium transport (PubMed:23169818). Reversibly converts between a voltage-insensitive potassium leak channel and a voltage-dependent outward rectifying potassium channel in a phosphorylation-dependent manner (PubMed:11319556). In astrocytes, forms mostly heterodimeric potassium channels with KCNK1, with only a minor proportion of functional channels containing homodimeric KCNK2. In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1

Function : Ion channel that contributes to passive transmembrane potassium transport

Involvement in disease :

Subcellular location : Isoform 1: Cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Isoform 4: Endoplasmic reticulum membrane, Multi-pass membrane protein

Protein Families : Two pore domain potassium channel (TC 1.A.1.8) family

Tissue Specificity : Isoform 4 is detected in kidney, adrenal gland and brain where it is preferentially expressed in the amygdala but not found in thalamus, hypothalamus, hippocampus or substantia nigra.

Paythway :

Uniprot ID : O95069