Product Description
Recombinant Human Potassium voltage-gated channel subfamily D member 1 (KCND1), partial is available at Gentaur for Next week Delivery.
Gene Name: KCND1
Alternative Names : Voltage-gated potassium channel subunit Kv4.1
Expression Region : 410-647aa
AA Sequence : NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL
Sequence Info : Cytoplasmic Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 27.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
Function : Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
Involvement in disease :
Subcellular location : Membrane, Multi-pass membrane protein, Cell projection, dendrite
Protein Families : Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.1/KCND1 sub-subfamily
Tissue Specificity : Widely expressed. Highly expressed in brain, in particular in cerebellum and thalamus; detected at lower levels in the other parts of the brain.
Paythway :
Uniprot ID : Q9NSA2
Euro
British Pound
US Dollar