Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1), partial (Active)

Product Description

Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: NRG1

Alternative Names : Pro-neuregulin-1;Neuregulin-1 beta 1;NRG1-beta 1;HRG1-beta 1; EGF;NRG1; GGF; HGL; HRGA; NDF; SMDF;

Expression Region : 177-241aa

AA Sequence : SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Sequence Info : Partial of Isoform 6

Tag Info : Tag-Free

Theoretical MW : 7.5 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 1xPBS, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a serum-free cell proliferation assay using MCF?7 human breast cancer cells is less than 3 ng/mL.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : neuregulin-1 (heregulin-1?NRG1) is a member of neuregulin family, which is comprised of four genes that encode a large number of secreted or membrane-bound isoforms. All family members share an EGF-like domain that interacts with the ErbB family of tyrosine kinase receptors. NRG1 isoforms can be classified into type I, type II and type III isoforms. NRG1 directs ligand for ERBB3 and ERBB4 tyrosine kinase receptors, concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG proteins show distinct spatial and temporal expression patterns and play important roles during development of both the nervous system and the heart.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q02297-6