Recombinant Human Proepiregulin (EREG), partial

Product Description

Recombinant Human Proepiregulin (EREG), partial is available at Gentaur for Next week Delivery.

Gene Name: EREG

Alternative Names : Epiregulin Short name: EPR

Expression Region : 60-119aa

AA Sequence : VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYV

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 22.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ligand of the EGF receptor/EGFR and ERBB4. May be a mediator of localized cell proliferation. As a mitogen it may stimulate cell proliferation and/or angiogenesis.

Function : Ligand of the EGF receptor/EGFR and ERBB4. Stimulates EGFR and ERBB4 tyrosine phosphorylation

Involvement in disease :

Subcellular location : Epiregulin: Secreted, extracellular space, SUBCELLULAR LOCATION: Proepiregulin: Cell membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity : In normal adults, expressed predominantly in the placenta and peripheral blood leukocytes. High levels were detected in carcinomas of the bladder, lung, kidney and colon.

Paythway : ErbBsignalingpathway

Uniprot ID : O14944