Euro
British Pound
US Dollar
Product Description
Recombinant Human Programmed cell death 1 ligand 2 (PDCD1LG2), partial is available at Gentaur for Next week Delivery.
Gene Name: PDCD1LG2
Alternative Names : Butyrophilin B7-DC (B7-DC) (CD_antigen: CD273) (B7DC) (CD273) (PDCD1L2) (PDL2)
Expression Region : 21-118aa
AA Sequence : FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 15.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production
Function : Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).
Involvement in disease :
Subcellular location : Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 2: Endomembrane system, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 1: Cell membrane, Single-pass type I membrane protein
Protein Families : Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity : Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus.
Paythway :
Uniprot ID : Q9BQ51
