Recombinant Human Programmed cell death protein 5 (PDCD5)

Product Description

Recombinant Human Programmed cell death protein 5 (PDCD5) is available at Gentaur for Next week Delivery.

Gene Name: PDCD5

Alternative Names : TF-1 cell apoptosis-related protein 19

Expression Region : 1-125aa

AA Sequence : MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 41.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May function in the process of apoptosis.

Function : May function in the process of apoptosis.

Involvement in disease :

Subcellular location :

Protein Families : PDCD5 family

Tissue Specificity : Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta.

Paythway :

Uniprot ID : O14737