Product Description
Recombinant Human Prominin-1 (PROM1), partial is available at Gentaur for Next week Delivery.
Gene Name: PROM1
Alternative Names : Antigen AC133;Prominin-like protein 1; CD133
Expression Region : 508-792aa
AA Sequence : GANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLN
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 34.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May play a role in cell differentiation, proliferation and apoptosis . Binds cholesterol in cholesterol-containing plasma mbrane microdomains and may play a role in the organization of the apical plasma mbrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner .
Function : May play a role in cell differentiation, proliferation and apoptosis
Involvement in disease : Retinitis pigmentosa 41 (RP41); Cone-rod dystrophy 12 (CORD12); Stargardt disease 4 (STGD4); Retinal macular dystrophy 2 (MCDR2)
Subcellular location : Apical cell membrane, Multi-pass membrane protein, Cell projection, microvillus membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment, Endoplasmic reticulum, Endoplasmic reticulum-Golgi intermediate compartment
Protein Families : Prominin family
Tissue Specificity : Isoform 1 is selectively expressed on CD34 hematopoietic stem and progenitor cells in adult and fetal bone marrow, fetal liver, cord blood and adult peripheral blood. Isoform 1 is not detected on other blood cells. Isoform 1 is also expressed in a number of non-lymphoid tissues including retina, pancreas, placenta, kidney, liver, lung, brain and heart. Found in saliva within small membrane particles. Isoform 2 is predominantly expressed in fetal liver, skeletal muscle, kidney, and heart as well as adult pancreas, kidney, liver, lung, and placenta. Isoform 2 is highly expressed in fetal liver, low in bone marrow, and barely detectable in peripheral blood. Isoform 2 is expressed on hematopoietic stem cells and in epidermal basal cells (at protein level). Expressed in adult retina by rod and cone photoreceptor cells (at protein level).
Paythway :
Uniprot ID : O43490
Euro
British Pound
US Dollar