Euro
British Pound
US Dollar
Product Description
Recombinant Human Protein delta homolog 1 (DLK1), partial is available at Gentaur for Next week Delivery.
Gene Name: DLK1
Alternative Names : pG2
Expression Region : 24-303aa
AA Sequence : AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 31.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May have a role in neuroendocrine differentiation.
Function : May have a role in neuroendocrine differentiation.
Involvement in disease :
Subcellular location : Membrane, Single-pass type I membrane protein
Protein Families :
Tissue Specificity : Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in some forms of neuroendocrine lung tumor tissue.
Paythway :
Uniprot ID : P80370
