Recombinant Human Protein delta homolog 2 (DLK2), partial

Product Description

Recombinant Human Protein delta homolog 2 (DLK2), partial is available at Gentaur for Next week Delivery.

Gene Name: DLK2

Alternative Names : Epidermal growth factor-like protein 9;EGF-like protein 9

Expression Region : 27-306aa

AA Sequence : DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPS

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 31.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Regulates adipogenesis.

Function : Regulates adipogenesis.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q6UY11