Recombinant Human Protein-lysine 6-oxidase (LOX), partial

Product Description

Recombinant Human Protein-lysine 6-oxidase (LOX), partial is available at Gentaur for Next week Delivery.

Gene Name: LOX

Alternative Names : Lysyl oxidase

Expression Region : 174-417aa

AA Sequence : PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 32.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. In addition to cross-linking of Extracellular domain matrix proteins, may have a direct role in tumor suppression.

Function : Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin

Involvement in disease : Aortic aneurysm, familial thoracic 10 (AAT10)

Subcellular location : Secreted, Secreted, extracellular space

Protein Families : Lysyl oxidase family

Tissue Specificity : Heart, placenta, skeletal muscle, kidney, lung and pancreas.

Paythway :

Uniprot ID : P28300