Recombinant Human Protein Mpv17 (MPV17)

Product Description

Recombinant Human Protein Mpv17 (MPV17) is available at Gentaur for Next week Delivery.

Gene Name: MPV17

Alternative Names :

Expression Region : 1-176aa

AA Sequence : MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 35.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.

Function : Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance.

Involvement in disease : Mitochondrial DNA depletion syndrome 6 (MTDPS6)

Subcellular location : Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families : Peroxisomal membrane protein PXMP2/4 family

Tissue Specificity : Ubiquitous. Expressed in pancreas, kidney, muscle, liver, lung, placenta, brain and heart.

Paythway :

Uniprot ID : P39210