Recombinant Human Protein phosphatase 1 regulatory subunit 1B (PPP1R1B)

Product Description

Recombinant Human Protein phosphatase 1 regulatory subunit 1B (PPP1R1B) is available at Gentaur for Next week Delivery.

Gene Name: PPP1R1B

Alternative Names : DARPP-32 Dopamine- and cAMP-regulated neuronal phosphoprotein

Expression Region : 1-168aa

AA Sequence : MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal GST-tagged

Theoretical MW : 45.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Inhibitor of protein-phosphatase 1.

Function : Inhibitor of protein-phosphatase 1.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Protein phosphatase inhibitor 1 family

Tissue Specificity :

Paythway : cAMPsignalingpathway

Uniprot ID : Q9UD71