Recombinant Human Protein phosphatase 1B (PPM1B)

Product Description

Recombinant Human Protein phosphatase 1B (PPM1B) is available at Gentaur for Next week Delivery.

Gene Name: PPM1B

Alternative Names : Protein phosphatase 2;C isoform beta;PP2;C-beta

Expression Region : 2-192aa

AA Sequence : SIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI

Sequence Info : Full Length of Isoform Beta-X

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 36.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Enzyme with a broad specificity. Dephosphorylates CDK2 and CDK6 in vitro. Dephosphorylates PRKAA1 and PRKAA2. Inhibits TBK1-mediated antiviral signaling by dephosphorylating it at 'Ser-172'. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB.

Function : Enzyme with a broad specificity. Dephosphorylates CDK2 and CDK6 in vitro. Dephosphorylates PRKAA1 and PRKAA2. Inhibits TBK1-mediated antiviral signaling by dephosphorylating it at 'Ser-172'. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB.

Involvement in disease :

Subcellular location : Cytoplasm, cytosol, Membrane, Lipid-anchor

Protein Families : PP2C family

Tissue Specificity : Highly expressed in heart and skeletal muscle.

Paythway : MAPKsignalingpathway

Uniprot ID : O75688