Recombinant Human Protein prune homolog (PRUNE)

Product Description

Recombinant Human Protein prune homolog (PRUNE) is available at Gentaur for Next week Delivery.

Gene Name: PRUNE

Alternative Names : Drosophila-related expressed sequence 17;DRES-17;DRES17HTcD37

Expression Region : 1-168aa

AA Sequence : MLRKDQKTIYRQGVKVAISAIYMDLEICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK

Sequence Info : Full Length of Isoform 6

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 22.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cell proliferation, is able to induce cell motility and acts as a negative regulator of NME1.

Function : Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cell proliferation, migration and differentiation, and acts as a negative regulator of NME1. Plays a role in the regulation of neurogenesis

Involvement in disease : Neurodevelopmental disorder with microcephaly, hypotonia, and variable brain anomalies (NMIHBA)

Subcellular location : Cytoplasm, Nucleus, Cell junction, focal adhesion

Protein Families : PPase class C family, Prune subfamily

Tissue Specificity : Ubiquitously expressed. Seems to be overexpressed in aggressive sarcoma subtypes, such as leiomyosarcomas and malignant fibrous histiocytomas (MFH) as well as in the less malignant liposarcomas.

Paythway :

Uniprot ID : Q86TP1