Product Description
Recombinant Human Protein S100-A1 (S100A1) is available at Gentaur for Next week Delivery.
Gene Name: S100A1
Alternative Names : S-100 protein alpha chain;S-100 protein subunit alpha;S100 calcium-binding protein A1
Expression Region : 2-94aa
AA Sequence : GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 26.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.
Function : Probably acts as a Ca(2+) signal transducer
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : S-100 family
Tissue Specificity : Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.
Paythway :
Uniprot ID : P23297
Euro
British Pound
US Dollar