Recombinant Human Protein S100-A10 (S100A10)

Product Description

Recombinant Human Protein S100-A10 (S100A10) is available at Gentaur for Next week Delivery.

Gene Name: S100A10

Alternative Names : Calpactin I light chain Calpactin-1 light chain Cellular ligand of annexin II S100 calcium-binding protein A10 p10 protein p11 ANX2LG, CAL1L, CLP11

Expression Region : 1-97aa

AA Sequence : MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 18.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.

Function : Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.

Involvement in disease :

Subcellular location :

Protein Families : S-100 family

Tissue Specificity :

Paythway :

Uniprot ID : P60903