Recombinant Human Protein S100-A3 (S100A3)

Product Description

Recombinant Human Protein S100-A3 (S100A3) is available at Gentaur for Next week Delivery.

Gene Name: S100A3

Alternative Names : Protein S-100E S100 calcium-binding protein A3

Expression Region : 1-101aa

AA Sequence : ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 38.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.

Function : Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : S-100 family

Tissue Specificity : Skin specific, specifically expressed at the inner endocuticle of hair fibers.

Paythway :

Uniprot ID : P33764