Recombinant Human Protein S100-A6 (S100A6)

Product Description

Recombinant Human Protein S100-A6 (S100A6) is available at Gentaur for Next week Delivery.

Gene Name: S100A6

Alternative Names : Calcyclin;Growth factor-inducible protein 2A9MLN 4Prolactin receptor-associated protein;PRAS100 calcium-binding protein A6

Expression Region : 1-90aa

AA Sequence : MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 26.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.

Function : May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.

Involvement in disease :

Subcellular location : Nucleus envelope, Cytoplasm, Cell membrane, Peripheral membrane protein, Cytoplasmic side

Protein Families : S-100 family

Tissue Specificity :

Paythway :

Uniprot ID : P06703