Product Description
Recombinant Human Protein S100-A6 (S100A6) is available at Gentaur for Next week Delivery.
Gene Name: S100A6
Alternative Names : Calcyclin;Growth factor-inducible protein 2A9MLN 4Prolactin receptor-associated protein;PRAS100 calcium-binding protein A6
Expression Region : 1-90aa
AA Sequence : MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 26.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.
Function : May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.
Involvement in disease :
Subcellular location : Nucleus envelope, Cytoplasm, Cell membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families : S-100 family
Tissue Specificity :
Paythway :
Uniprot ID : P06703
Euro
British Pound
US Dollar