Euro
British Pound
US Dollar
Product Description
Recombinant Human Protein transport protein Sec16A (SEC16A), partial is available at Gentaur for Next week Delivery.
Gene Name: SEC16A
Alternative Names : SEC16 homolog A
Expression Region : 1943-2154aa
AA Sequence : AYLPDDKNKSIVWDEKKNQWVNLNEPEEEKKAPPPPPTSMPKTVQAAPPALPGPPGAPVNMYSRRAAGTRARYVDVLNPSGTQRSEPALAPADFVAPLAPLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKLSRCSSMSSLSREVSQHFNQAPGDLPAAGGPPSGAMPFYNPAQLAQACATSGSSRLGRIGQRKHLVLN
Sequence Info : Partial of Isoform 4
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 26.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Defines endoplasmic reticulum exit sites (ERES) and is required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus. SAR1A-GTP-dependent assbly of SEC16A on the ER mbrane forms an organized scaffold defining an ERES. Required for normal transitional endoplasmic reticulum (tER) organization.
Function : Defines endoplasmic reticulum exit sites (ERES) and is required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining an ERES. Required for normal transitional endoplasmic reticulum (tER) organization.
Involvement in disease :
Subcellular location : Endoplasmic reticulum membrane, Peripheral membrane protein, Golgi apparatus membrane, Peripheral membrane protein
Protein Families : SEC16 family
Tissue Specificity : Ubiquitous. Expressed at higher levels in the pancreas.
Paythway :
Uniprot ID : O15027
