Recombinant Human Pulmonary surfactant-associated protein A2 (SFTPA2)

Product Description

Recombinant Human Pulmonary surfactant-associated protein A2 (SFTPA2) is available at Gentaur for Next week Delivery.

Gene Name: SFTPA2

Alternative Names : Collectin-5

Expression Region : 21-248aa

AA Sequence : EVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Theoretical MW : 41.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration.

Function : In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration.

Involvement in disease : Pulmonary fibrosis, idiopathic (IPF)

Subcellular location : Secreted, extracellular space, extracellular matrix, Secreted, extracellular space, surface film

Protein Families : SFTPA family

Tissue Specificity :

Paythway :

Uniprot ID : Q8IWL1