Recombinant Human Pulmonary surfactant-associated protein C (SFTPC)

Product Description

Recombinant Human Pulmonary surfactant-associated protein C (SFTPC) is available at Gentaur for Next week Delivery.

Gene Name: SFTPC

Alternative Names : Pulmonary surfactant-associated proteolipid SPL(Val)SP5

Expression Region : 24-58aa

AA Sequence : FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 5.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Function : Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Involvement in disease : Pulmonary surfactant metabolism dysfunction 2 (SMDP2); Respiratory distress syndrome in premature infants (RDS)

Subcellular location : Secreted, extracellular space, surface film

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P11686