Product Description
Recombinant Human Putative inactive neutral ceramidase B (ASAH2B) is available at Gentaur for Next week Delivery.
Gene Name: ASAH2B
Alternative Names : ASAH2-like protein;Putative inactive N-acylsphingosine amidohydrolase 2BPutative inactive non-lysosomal ceramidase B
Expression Region : 1-165aa
AA Sequence : MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 21 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location :
Protein Families : Neutral ceramidase family
Tissue Specificity : Ubiquitous. Expression is reduced with increasing age and in late-onset Alzheimer disease (LOAD) patients. This reduction is even more pronounced in patients with an affected mother.
Paythway :
Uniprot ID : P0C7U1