Recombinant Human Putative RNA-binding protein 3 (RBM3)

Product Description

Recombinant Human Putative RNA-binding protein 3 (RBM3) is available at Gentaur for Next week Delivery.

Gene Name: RBM3

Alternative Names : RNA-binding motif protein 3RNPL

Expression Region : 1-157aa

AA Sequence : MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 19.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic tperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation .

Function : Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation (By similarity).

Involvement in disease :

Subcellular location : Nucleus, Cytoplasm, Cell projection, dendrite

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P98179