Product Description
Recombinant Human Rab-like protein 5 (RABL5) is available at Gentaur for Next week Delivery.
Gene Name: RABL5
Alternative Names : Rab-like protein 5
Expression Region : 1-185aa
AA Sequence : MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMT
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 36.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Small GTPase-like component of the intraflagellar transport (IFT) complex B.
Function : Small GTPase-like component of the intraflagellar transport (IFT) complex B.
Involvement in disease :
Subcellular location : Cell projection, cilium
Protein Families : Small GTPase superfamily, Rab family
Tissue Specificity :
Paythway :
Uniprot ID : Q9H7X7
Euro
British Pound
US Dollar