Recombinant Human Ras-related C3 botulinum toxin substrate 3 (RAC3)

Product Description

Recombinant Human Ras-related C3 botulinum toxin substrate 3 (RAC3) is available at Gentaur for Next week Delivery.

Gene Name: RAC3

Alternative Names : p21-Rac3

Expression Region : 1-192aa

AA Sequence : MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 48 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner.

Function : Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner.

Involvement in disease :

Subcellular location : Cytoplasm, Endomembrane system, Cell projection, lamellipodium, Cytoplasm, perinuclear region, Cell membrane, Cytoplasm, cytoskeleton

Protein Families : Small GTPase superfamily, Rho family

Tissue Specificity : Highest levels in brain, also detected in heart, placenta and pancreas.

Paythway : cAMPsignalingpathway

Uniprot ID : P60763