Euro
British Pound
US Dollar
Product Description
Recombinant Human Ras-related protein R-Ras2 (RRAS2) is available at Gentaur for Next week Delivery.
Gene Name: RRAS2
Alternative Names : Ras-like protein TC21 Teratocarcinoma oncogene
Expression Region : 1-204aa
AA Sequence : MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 50.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.
Function : It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.
Involvement in disease : Ovarian cancer (OC)
Subcellular location : Cell membrane, Lipid-anchor, Cytoplasmic side
Protein Families : Small GTPase superfamily, Ras family
Tissue Specificity : Ubiquitously present in all tissues examined, with the highest levels in heart, placenta, and skeletal muscle. Moderate levels in lung and liver; low levels in brain, kidney, and pancreas.
Paythway : cAMPsignalingpathway
Uniprot ID : P62070
