Recombinant Human Ras-related protein Rab-27B (RAB27B)

Product Description

Recombinant Human Ras-related protein Rab-27B (RAB27B) is available at Gentaur for Next week Delivery.

Gene Name: RAB27B

Alternative Names : C25KG

Expression Region : 2-218aa

AA Sequence : TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 40.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in targeting uroplakins to urothelial apical mbranes.

Function : May be involved in targeting uroplakins to urothelial apical membranes.

Involvement in disease :

Subcellular location : Membrane, Lipid-anchor

Protein Families : Small GTPase superfamily, Rab family

Tissue Specificity : Expressed primarily in testis.

Paythway :

Uniprot ID : O00194