Product Description
Recombinant Human Ras-related protein Rab-27B (RAB27B) is available at Gentaur for Next week Delivery.
Gene Name: RAB27B
Alternative Names : C25KG
Expression Region : 2-218aa
AA Sequence : TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 40.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May be involved in targeting uroplakins to urothelial apical mbranes.
Function : May be involved in targeting uroplakins to urothelial apical membranes.
Involvement in disease :
Subcellular location : Membrane, Lipid-anchor
Protein Families : Small GTPase superfamily, Rab family
Tissue Specificity : Expressed primarily in testis.
Paythway :
Uniprot ID : O00194
Euro
British Pound
US Dollar