Recombinant Human Ras-related protein Rab-3C (RAB3C)

Product Description

Recombinant Human Ras-related protein Rab-3C (RAB3C) is available at Gentaur for Next week Delivery.

Gene Name: RAB3C

Alternative Names :

Expression Region : 1-227aa

AA Sequence : MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 42 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Protein transport. Probably involved in vesicular traffic .

Function : Protein transport. Probably involved in vesicular traffic (By similarity).

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, Cytoplasmic side

Protein Families : Small GTPase superfamily, Rab family

Tissue Specificity : Expressed in brain, placenta and lung.

Paythway : Excitatorysynapsepathway

Uniprot ID : Q96E17