Recombinant Human Ras-specific guanine nucleotide-releasing factor RalGPS1 (RALGPS1)

Product Description

Recombinant Human Ras-specific guanine nucleotide-releasing factor RalGPS1 (RALGPS1) is available at Gentaur for Next week Delivery.

Gene Name: RALGPS1

Alternative Names : Ral GEF with PH domain and SH3-binding motif 1Ral guanine nucleotide exchange factor 2;RalGEF 2RalA exchange factor RalGPS1

Expression Region : 1-305aa

AA Sequence : MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAAM

Sequence Info : Full Length of Isoform 4

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 50.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization . Guanine nucleotide exchange factor for.

Function : Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization (By similarity). Guanine nucleotide exchange factor for.

Involvement in disease :

Subcellular location : Cytoplasm, Cell membrane

Protein Families :

Tissue Specificity : Widely expressed (at protein level). Isoform 2 is expressed in brain, colon, kidney, pancreas, prostate, skeletal muscle, small intestine, testis, thymus and uterus. Isoform 1 is expressed at high levels in heart and testis and at lower levels in brain, pancreas, skeletal muscle, small intestine and thymus.

Paythway :

Uniprot ID : Q5JS13