Product Description
Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells (EBAG9), partial is available at Gentaur for Next week Delivery.
Gene Name: EBAG9
Alternative Names : Cancer-associated surface antigen R;CAS1;Estrogen receptor-binding fragment-associated gene 9 protein
Expression Region : 28-213aa
AA Sequence : RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
Sequence Info : Cytoplasmic Domain
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 37.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Apoptosis
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.
Function : May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.
Involvement in disease :
Subcellular location : Golgi apparatus membrane, Single-pass type III membrane protein
Protein Families :
Tissue Specificity : Widely expressed. Expressed in ovary, testis, prostate, thymus, muscle and heart, but not in small intestine, colon, lymph nodes, or peripherical blood lymphocytes. The protein is not detected in any of the above organs.
Paythway : Estrogensignalingpathway
Uniprot ID : O00559
Euro
British Pound
US Dollar