Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial

Product Description

Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial is available at Gentaur for Next week Delivery.

Gene Name: PTPRZ1

Alternative Names : Protein-tyrosine phosphatase receptor type Z polypeptide 1 (Protein-tyrosine phosphatase receptor type Z polypeptide 2) (R-PTP-zeta-2) (HTPZP2) (PTPRZ) (PTPRZ2) (PTPZ)

Expression Region : 36-300aa

AA Sequence : IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY

Sequence Info : partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 34.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades

Function : Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades (By similarity).

Involvement in disease :

Subcellular location : Isoform 1: Cell membrane, Single-pass type I membrane protein, Secreted

Protein Families : Protein-tyrosine phosphatase family, Receptor class 5 subfamily

Tissue Specificity : Specifically expressed in the central nervous system, where it is localized in the Purkinje cell layer of the cerebellum, the dentate gyrus, and the subependymal layer of the anterior horn of the lateral ventricle. Developmentally regulated in the brain.

Paythway :

Uniprot ID : P23471