Recombinant Human Resistin-like beta (RETNLB)

Product Description

Recombinant Human Resistin-like beta (RETNLB) is available at Gentaur for Next week Delivery.

Gene Name: RETNLB

Alternative Names : Colon and small intestine-specific cysteine-rich protein Colon carcinoma-related gene protein Cysteine-rich secreted protein A12-alpha-like 1 Cysteine-rich secreted protein FIZZ2 RELMbeta

Expression Region : 24-111aa

AA Sequence : QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 11.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probable hormone.

Function : Probable hormone.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Resistin/FIZZ family

Tissue Specificity : Expressed only in the gastrointestinal tract, particularly the colon.

Paythway :

Uniprot ID : Q9BQ08