Recombinant Human Reticulocalbin-1 (RCN1), partial

Product Description

Recombinant Human Reticulocalbin-1 (RCN1), partial is available at Gentaur for Next week Delivery.

Gene Name: RCN1

Alternative Names :

Expression Region : 31-331aa

AA Sequence : PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 37.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.

Function : May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.

Involvement in disease :

Subcellular location : Endoplasmic reticulum lumen

Protein Families : CREC family

Tissue Specificity :

Paythway :

Uniprot ID : Q15293