Product Description
Recombinant Human Rhodopsin (RHO), partial is available at Gentaur for Next week Delivery.
Gene Name: RHO
Alternative Names : Opsin-2
Expression Region : 1-36aa
AA Sequence : MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQ
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 20.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change leading to G-protein activation and release of all-trans retinal.
Function : Photoreceptor required for image-forming vision at low light intensity
Involvement in disease : Retinitis pigmentosa 4 (RP4); Night blindness, congenital stationary, autosomal dominant 1 (CSNBAD1)
Subcellular location : Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families : G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity : Rod shaped photoreceptor cells which mediate vision in dim light.
Paythway :
Uniprot ID : P08100
Euro
British Pound
US Dollar