Recombinant Human Rhombotin-1 (LMO1), partial

Product Description

Recombinant Human Rhombotin-1 (LMO1), partial is available at Gentaur for Next week Delivery.

Gene Name: LMO1

Alternative Names : Cysteine-rich protein TTG-1LIM domain only protein 1;LMO-1T-cell translocation protein 1

Expression Region : 5-156aa

AA Sequence : DKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 44.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.

Function : May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.

Involvement in disease : A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p15;q11) with TCRD.

Subcellular location : Nucleus

Protein Families :

Tissue Specificity : Expressed mainly in the central nervous. Low level of expression in other tissues including thymus.

Paythway :

Uniprot ID : P25800