Product Description
Recombinant Human Rhombotin-1 (LMO1), partial is available at Gentaur for Next week Delivery.
Gene Name: LMO1
Alternative Names : Cysteine-rich protein TTG-1LIM domain only protein 1;LMO-1T-cell translocation protein 1
Expression Region : 5-156aa
AA Sequence : DKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 44.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
Function : May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
Involvement in disease : A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p15;q11) with TCRD.
Subcellular location : Nucleus
Protein Families :
Tissue Specificity : Expressed mainly in the central nervous. Low level of expression in other tissues including thymus.
Paythway :
Uniprot ID : P25800
Euro
British Pound
US Dollar