Recombinant Human Ribonuclease 4 (RNASE4)

Product Description

Recombinant Human Ribonuclease 4 (RNASE4) is available at Gentaur for Next week Delivery.

Gene Name: RNASE4

Alternative Names : RNS4

Expression Region : 29-147aa

AA Sequence : QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal MBP-tagged and C-terminal 6xHis-tagged

Theoretical MW : 57.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This RNase has marked specificity towards the 3' side of uridine nucleotides.

Function : This RNase has marked specificity towards the 3' side of uridine nucleotides.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Pancreatic ribonuclease family

Tissue Specificity :

Paythway :

Uniprot ID : P34096