Recombinant Human Ribonuclease P protein subunit p20 (POP7)

Product Description

Recombinant Human Ribonuclease P protein subunit p20 (POP7) is available at Gentaur for Next week Delivery.

Gene Name: POP7

Alternative Names : Ribonucleases P/MRP protein subunit POP7 homolog

Expression Region : 1-140aa

AA Sequence : MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 42.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP complex, which cleaves pre-rRNA sequences.

Function : Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP complex, which cleaves pre-rRNA sequences.

Involvement in disease :

Subcellular location : Nucleus, nucleolus, Cytoplasm, Cytoplasmic granule

Protein Families : Histone-like Alba family

Tissue Specificity :

Paythway :

Uniprot ID : O75817