Recombinant Human RING-box protein 2 (RNF7)

Product Description

Recombinant Human RING-box protein 2 (RNF7) is available at Gentaur for Next week Delivery.

Gene Name: RNF7

Alternative Names : CKII beta-binding protein 1;CKBBP1RING finger protein 7Regulator of cullins 2Sensitive to apoptosis gene protein

Expression Region : 2-113aa

AA Sequence : ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 14.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, ses to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.

Function : Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families : RING-box family

Tissue Specificity : Expressed in heart, liver, skeletal muscle and pancreas. At very low levels expressed in brain, placenta and lung.

Paythway : Ubiquitinmediatedproteolysis

Uniprot ID : Q9UBF6