Recombinant Human Sal-like protein 2 (SALL2)

Product Description

Recombinant Human Sal-like protein 2 (SALL2) is available at Gentaur for Next week Delivery.

Gene Name: SALL2

Alternative Names : Zinc finger protein 795 Zinc finger protein SALL2 Zinc finger protein Spalt-2 Short name: Sal-2 Short name: hSal2

Expression Region : 1-198aa

AA Sequence : QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN

Sequence Info : Partial

Tag Info : N-terminal Flag-Myc-tagged

Theoretical MW : 25.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probable transcription factor that plays a role in eye development before, during, and after optic fissure closure.

Function : Probable transcription factor that plays a role in eye development before, during, and after optic fissure closure.

Involvement in disease : Coloboma, ocular, autosomal recessive (COAR)

Subcellular location : Nucleus

Protein Families : Sal C2H2-type zinc-finger protein family

Tissue Specificity : Highest levels in adult brain (in different areas). Lower levels in heart; very low levels in kidney and pancreas. Expressed throughout the retina and lens vesicle as well as the periocular mesenchyme.

Paythway :

Uniprot ID : Q9Y467